PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 375aa    MW: 41677.2 Da    PI: 7.0761
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029876.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ + +++G+g +W + ++++g++R++k+c++rw++yl
      Pbr029876.1 14 KGPWSPEEDTTLKAYMEKHGTGgNWIALPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.84.5e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Pbr029876.1  69 GGFSEEEDNIICSLYMSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.576962IPR017930Myb domain
SuperFamilySSF466899.39E-2711109IPR009057Homeodomain-like
SMARTSM007171.7E-111364IPR001005SANT/Myb domain
PfamPF002491.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-241569IPR009057Homeodomain-like
CDDcd001671.16E-81662No hitNo description
PROSITE profilePS5129421.17463117IPR017930Myb domain
SMARTSM007173.1E-1167115IPR001005SANT/Myb domain
PfamPF002495.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370117IPR009057Homeodomain-like
CDDcd001672.34E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDTTLKAYME KHGTGGNWIA LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYMSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
QRKQQQVQQS RRTASFKQEM IKRSENIANF INIPAGFDNQ NPYDLPELPV VPVTNYQTHN  180
PQLIKDQASI KNMLINLGGR FSHDSDTSNT SFQYPIDILS TSSSDQQFYQ SSINVLSCTS  240
AANSNNYSQF PSTHCDASNG TGGSSSPTMF HGLNDQNNNL QVDHLHQLSE LEVYDNNFAH  300
QHQQLGGFYY QATTETLNNG STAGTSTASA ESEISWGDIN SLVYSTQMVA GYETSCPQAV  360
TVPPDLHAVF AEST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338967.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5WKM30.0M5WKM3_PRUPE; Uncharacterized protein
STRINGVIT_00s1352g00010.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-75myb domain protein 84